PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 331aa    MW: 36461.6 Da    PI: 7.3078
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002056genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      Lus10002056 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding521.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10002056  67 RGNFTQEEEKMIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.55961IPR017930Myb domain
SuperFamilySSF466897.34E-3111108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002495.8E-161461IPR001005SANT/Myb domain
CDDcd001671.97E-111661No hitNo description
PROSITE profilePS5129425.32862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2565116IPR009057Homeodomain-like
SMARTSM007177.7E-1766114IPR001005SANT/Myb domain
PfamPF002492.1E-1567112IPR001005SANT/Myb domain
CDDcd001672.38E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRPPCCDKA GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TQEEEKMIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLHNNN  120
KGGTTTGHHH STSSSSDSNR GKWERRLQTD IGLAKQALSD ALSLHTKKPT TAEDKTKLPL  180
DNPPNYASSA DNIARLLQNW IKKPPSTSTP STITQAETKS DVTRNSVSSS SGDDNDNFEL  240
LFGFHNGSPN SEGGSQTVDE DGVIMDERKP VRVEDYGVSP PTLSLLEKWL FEETTTAVPA  300
ANNVHCVDEL MNISTLDGAG SASGFGDVRF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-26141164105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488913.11e-112PREDICTED: myb-related protein 306
RefseqXP_008230764.11e-112PREDICTED: myb-related protein 306
SwissprotP813921e-104MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2T8E91e-112A0A0D2T8E9_G
STRINGVIT_14s0108g00830.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-88myb domain protein 94